Biochemical Reagents
Cayman Chemical AmyloId-1-42 PeptIdetrI 500ug
A 42-amino acid protein fragment of amyloid-β; found in amyloid plaques in postmortem cerebral cortex from patients with Alzheimer’s disease; aggregation results in the formation of neurotoxic fibrils or globular oligomers; accumulates in the brain of many transgenic mouse models of Alzheimer’s disease and, in many models, the onset of amyloid deposition positively correlates with deficits in spatial learning and memory
Medchemexpress LLC HY-P1455A 1mg Medchemexpress, Adrenomedullin (AM) (1-52), human (TFA) CAS: Purity:>98%
Medchemexpress, HY-P1455A 1mg Adrenomedullin (AM) (1-52), human (TFA) CAS: Adrenomedullin (AM) (1-52), human (TFA) affects cell proliferation and angiogenesis in cancer. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Medchemexpress LLC Galanin (1-30), human | 119418-04-1 | 99.9% | 3157.46 | 500 UG
Galanin (1-30), human is a 30-amino acid neuropeptide that acts as an agonist of GalR1 and GalR2 receptors, with Kis of both 1 nM.
- Agonist of GalR1 and GalR2 receptors, with Kis of both 1 nM.
- Displaces 125I-labeled rat galanin with a Kd of 0.5 nM.
- Causes contractions of isolated longitudinal rat fundus strips, with an ED50 of 13.8 ± 1.6 nM.
CPC Scientific H-Ser-Cys-Ser-Leu-Pro-Gln-Thr-Ser-Gly-Leu-Gln-Lys-Pro-Glu-Ser-NH2 (trifluoroacetate salt) 1MG
Peptide that is capable of mimicking the effects of recombinant leptin on body weight and food intake in female ob/ob mice that lack endogenously circulating active leptin. It also may cause body weight loss and food intake. ONE-LETTER SEQUENCE: SCSLPQTSGLQKPES-NH2MOLECULAR FORMULA: C64H109N19O24S1MOLECULAR WEIGHT:1560.75STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [258276-95-8], SYNONYMS: Leptin (116-130) amide (mouse)RESEARCH AREA: ObesityREFERENCES: P. Grasso et al., Endocrinology 138, 1413 (1997)
![Bachem ([13C6]Leu15)-pTH (1-34) (human) Trifluoroacetate](https://assets.fishersci.com/TFS-Assets/CCG/product-images/501946980.jpg-250.jpg)
Bachem ([13C6]Leu15)-pTH (1-34) (human) Trifluoroacetate
([13C6]Leu15)-pTH (1-34) (human) Trifluoroacetate, H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-[13C6]Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH, 1927927-15-8, C17513C6H291N55O51S2, Mr 4123.71, 1mg. ([13C6]Leu15)-Teriparatide. Heavy isotope-labeled human pTH (1-34) (Teriparatide) useful for pharmacokinetic/pharmacodynamic studies in combination with Bachem product H-4835 pTH (1-34) (human) or the corresponding generic API.
CPC Scientific H-Asp-Val-Thr-Ala-Pro-Leu-Val-Asp-Glu-Gly-Ala-Pro-Gly-Lys-Gln-Ala-Ala-Ala-Gln-Pro-His-Thr-Glu-Ile-Pro-Glu-Gly-Thr-Thr-OH (trifluoroacetate salt) 5MG
TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer?s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus (see figure below). Tau Peptide (74-102) is a 29-amino acid long peptide derived from the Exon 3/Insert 2 domain.ONE-LETTER SEQUENCE: DVTAPLVDEGAPGKQAAAQPHTEIPEGTTMOLECULAR FORMULA: C124H198N34O46MOLECULAR WEIGHT:2901.14STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1322695-34-0], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: Buee, L. et al. Brain Res Rev 33 95 (2000). Trinczek, B. et al. Mol Biol Cell 6, 1887 (1995).
Medchemexpress LLC Ddo-5936 | 2355377-13-6 | MFCD33398564 | 99.2% | 495.59 g·mol⁻¹ | C25H29N5O4S | 5 MG
DDO-5936 is a small-molecule inhibitor that selectively disrupts the protein-protein interaction between heat shock protein 90 (Hsp90) and Cdc37. It is used in preclinical research to probe Hsp90-Cdc37-dependent signaling and has been applied in colorectal cancer studies. Supplied as a high-purity solid for solution preparation and biological testing.
- Potent and specific Hsp90-Cdc37 PPI inhibitor.
- High purity (99.2%) suitable for biochemical assays.
- Provided as a solid for stable storage and handling.
- Soluble in common polar organic solvents for assay preparation.
- Validated in cellular and in vivo colorectal cancer models.
CPC Scientific Pyr-Thr-Phe-Gln-Tyr-Ser-Arg-Gly-Trp-Thr-Asn-NH2 (trifluoroacetate salt) 5MG
Corazonin is a cardioaccelerating peptide, which has been isolated from the corpus cardiacum of the American cockroach, Periplaneta americana. It is the most potent insect cardioactive neuropeptide.ONE-LETTER SEQUENCE: Pyr-TFQYSRGWTN-NH2MOLECULAR FORMULA: C62H84N18O18MOLECULAR WEIGHT:1369.46STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [122929-08-2], RESEARCH AREA: NeuropeptidesREFERENCES: J.A.Veenstra, FEBS Lett., 250, 231 (1989)
Bachem Tide FluorTM 2-LL-37 Trifluoroacetate
Tide FluorTM 2-LL-37 Trifluoroacetate, Tide FluorTM 2-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH, , C205H340N60O53 + dye, Mr 4962, 0.1mg. Dye-labeled LL-37, excitation 500nm, emission 527nm. Tide FluorTM-2 shows an excellent photostability and brightness, its fluorescence is pH-insensitive.
eMolecules 1262751-08-5 | Medchem Express | OVA Peptide(257-264) (TFA) | 1mg | 451965632 | HY-P1489A | MFCD18452854 | 1077.167 | C47H75F3N10O15
Medchem Express | GCN2-IN-1 | 5mg | 446256246 | HY-100877 | 1448693-69-3 | 402.422 | C19H18N10O
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool<|a>
CPC Scientific H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 (trifluoroacetate salt) 1MG
A new member of the Glucagon superfamily that was originally isolated from the venom of the lizard, Heloderma Horridum. At low concentrations, it interacts with putative exendin receptors causing an increase in pancreatic acinar cAMP, while at higher concentrations it interacts with VIP receptors to stimulate an increase in cellular cAMP and amylase release. ONE-LETTER SEQUENCE: HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2MOLECULAR FORMULA: C184H282N50O61S1MOLECULAR WEIGHT:4202.63STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [130357-25-4], RESEARCH AREA: DiabetesREFERENCES: J. Eng et al., J. Biol. Chem., 267, 7402 (1992)
Cayman Chemical 17 R-ResolvIn D3 50UG
An aspirin-triggered epimer of resolvin D3; has been found in mouse inflammatory exudates; reduces transmigration of neutrophils into the peritoneal cavity, as well as decreases the levels of IL-6 and increases the levels of IL-10 in inflammatory exudate in a mouse model of zymosan-induced peritonitis at 10 ng/animal; activates GPR32 in a β-arrestin reporter assay and increases phagocytosis to a greater degree in CHO cells overexpressing GPR32 compared to mock-transfected cells; increases phagocytosis of etoposide-generated tumor cell debris by monocyte-derived macrophages in H460 human lung carcinoma cells in a concentration-dependent manner; inhibits tumor growth in a mouse model of Lewis lung carcinoma at 0.6 UG/kg per day
Bachem TRAP-5 amide Trifluoroacetate
TRAP-5 amide Trifluoroacetate, H-Ser-Phe-Leu-Leu-Arg-NH2, 141923-41-3, C30H51N9O6, Mr 633.79, 25mg. SFLLRamide, Thrombin Receptor Activator Peptide 5 amide, PAR-1 (1-5) amide (human), Proteinase Activated Receptor 1 (1-5) amide (human), Thrombin Receptor (1-5) amide (human), Coagulation Factor II Receptor (1-5) amide (human). SFLLR-amide, thrombin receptor agonist peptide.
Medchemexpress LLC HY-108741A 10mg Medchemexpress, Plecanatide acetate CAS:1075732-84-1 Purity:>98%
Medchemexpress, HY-108741A 10mg Plecanatide acetate CAS:1075732-84-1 Plecanatide acetate is a guanylate cyclase-C (GC-C) receptor agonist, with an EC50 of 190 nM in T84 cells. Plecanatide acetate shows anti-inflammatory activity in models of murine colitis. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.